PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C006728P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 304aa    MW: 33254.8 Da    PI: 5.152
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C006728P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.19.9e-191865148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd +l+++++ +G g+W++ ar+ g++Rt+k+c++rw++yl
   MELO3C006728P1 18 RGPWTVEEDIILINYIANHGDGRWNSLARCAGLKRTGKSCRLRWLNYL 65
                     89********************************************97 PP

2Myb_DNA-binding49.51e-1571114146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T eE++l+++++ ++G++ W++Ia+ ++ gRt++++k++w++
   MELO3C006728P1  71 RGNITLEEQLLILELHSRWGNR-WSKIAQQLP-GRTDNEIKNYWRT 114
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.6781369IPR017930Myb domain
SuperFamilySSF466892.19E-3015112IPR009057Homeodomain-like
SMARTSM007173.6E-151767IPR001005SANT/Myb domain
PfamPF002499.9E-171865IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.7E-231972IPR009057Homeodomain-like
CDDcd001671.49E-122065No hitNo description
PROSITE profilePS5129418.20870120IPR017930Myb domain
SMARTSM007178.3E-1470118IPR001005SANT/Myb domain
PfamPF002492.1E-1471114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-2273119IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MFDSGTLHGG EDDSDLRRGP WTVEEDIILI NYIANHGDGR WNSLARCAGL KRTGKSCRLR  60
WLNYLRPDVR RGNITLEEQL LILELHSRWG NRWSKIAQQL PGRTDNEIKN YWRTRVQKHA  120
KQLKCDVNSK QFKDTMRYLW MPRLVERIQA AAVSSVAASA VVDGSGSYGS VTPTPPALMM  180
NGGSDFVSTP QVTPSYTSEN SSSGGGGGSS DGTQVSSVSE LTDCYNNFSC NFPAGYEQDA  240
GAGAASMQSP AGGLFFNEGT LDFQAMQQSS CEWMAGDGGV DTSESLWNGA GADYFWFLQQ  300
QLN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-251311222120MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818480.0LN681848.1 Cucumis melo genomic scaffold, anchoredscaffold00006.
GenBankLN7132600.0LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008438973.10.0PREDICTED: transcription factor MYB108
SwissprotQ9LDE12e-84MY108_ARATH; Transcription factor MYB108
TrEMBLA0A0A0L5Y40.0A0A0A0L5Y4_CUCSA; Uncharacterized protein
STRINGPOPTR_0010s15970.11e-117(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87534125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49620.11e-83myb domain protein 78